Lineage for d2ij9b_ (2ij9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905225Protein Uridylate kinase PyrH [142728] (6 species)
  7. 2905226Species Archaeoglobus fulgidus [TaxId:2234] [142732] (1 PDB entry)
    Uniprot O28237 1-219
  8. 2905228Domain d2ij9b_: 2ij9 B: [137464]
    automated match to d2ij9a1
    complexed with so4

Details for d2ij9b_

PDB Entry: 2ij9 (more details), 2.9 Å

PDB Description: crystal structure of uridylate kinase from archaeoglobus fulgidus
PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2ij9b_:

Sequence, based on SEQRES records: (download)

>d2ij9b_ c.73.1.3 (B:) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]}
mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyiksarelgaset
fcdyigiaatrlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdata
allaefikadvfinatnvdgvysadpksdtsavkydrlspqqlveivsrssakagtnvvi
dllaakiierskiktyvilgtpenimkavkgeavgtvia

Sequence, based on observed residues (ATOM records): (download)

>d2ij9b_ c.73.1.3 (B:) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]}
mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyiksarelgaset
fcdyigiaatrlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdata
allaefikadvfinatnvdgvysadpksdtsavkydrlspqqlveivsrssgtnvvidll
aakiierskiktyvilgtpenimkavkgeavgtvia

SCOPe Domain Coordinates for d2ij9b_:

Click to download the PDB-style file with coordinates for d2ij9b_.
(The format of our PDB-style files is described here.)

Timeline for d2ij9b_: