![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (1 family) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (21 proteins) |
![]() | Protein Cyp121 monooxygenase (P450 Mt2) [81865] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [81866] (4 PDB entries) |
![]() | Domain d2ij7b1: 2ij7 B:6-396 [137458] automatically matched to d1n40a_ complexed with hem, tpf |
PDB Entry: 2ij7 (more details), 1.9 Å
SCOP Domain Sequences for d2ij7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ij7b1 a.104.1.1 (B:6-396) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} llevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmket aaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldnli tegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdrd ieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfltta lisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkgelv lvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieallkk mpgvdlavpidqlvwrtrfqrriperlpvlw
Timeline for d2ij7b1: