SCOPe 2.03: Domain d2ij0b2: 2ij0 B:94-194

Lineage for d2ij0b2 (2ij0 B:94-194)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)

8. Domain d2ij0b2: 2ij0 B:94-194 [137448]
   Other proteins in same PDB: d2ij0a1, d2ij0b1, d2ij0c1, d2ij0e_
   automated match to d2tssa2

Details for d2ij0b2

PDB Entry: 2ij0, 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1

PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d2ij0b2:

Sequence; same for both SEQRES and ATOM records:

>d2ij0b2 d.15.6.1 (B:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d2ij0b2:

• d2ij0b2 first appeared in SCOP 1.73
  
• d2ij0b2 appears in SCOPe 2.02
  
• d2ij0b2 appears in SCOPe 2.04
  
• d2ij0b2 appears in the current release, SCOPe 2.08