SCOP 1.73: Domain d2ij0b1: 2ij0 B:4-93

Lineage for d2ij0b1 (2ij0 B:4-93)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)

8. Domain d2ij0b1: 2ij0 B:4-93 [137447]
   Other proteins in same PDB: d2ij0a2, d2ij0b2
   automatically matched to d1aw7a1

Details for d2ij0b1

PDB Entry: 2ij0, 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1

PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOP Domain Sequences for d2ij0b1:

Sequence; same for both SEQRES and ATOM records:

>d2ij0b1 b.40.2.2 (B:4-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
dnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvd
lntkrtkksqhtsegtyihfqisgvtntek

Timeline for d2ij0b1:

• d2ij0b1 is new in SCOP 1.73
  
• d2ij0b1 appears in SCOP 1.75
  
• d2ij0b1 appears in the current release, SCOPe 2.08