Lineage for d2ij0a2 (2ij0 A:94-194)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 718015Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 718016Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 718037Domain d2ij0a2: 2ij0 A:94-194 [137446]
    Other proteins in same PDB: d2ij0a1, d2ij0b1
    automatically matched to d1aw7a2

Details for d2ij0a2

PDB Entry: 2ij0 (more details), 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOP Domain Sequences for d2ij0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ij0a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOP Domain Coordinates for d2ij0a2:

Click to download the PDB-style file with coordinates for d2ij0a2.
(The format of our PDB-style files is described here.)

Timeline for d2ij0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ij0a1