Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins) Pfam PF04261 |
Protein Melanin biosynthesis protein TyrA [143270] (1 species) |
Species Shewanella oneidensis [TaxId:70863] [143271] (2 PDB entries) Uniprot Q8EIU4 5-311 |
Domain d2iiza_: 2iiz A: [137444] automated match to d2haga1 complexed with edo, hem, ipa, na |
PDB Entry: 2iiz (more details), 2.3 Å
SCOPe Domain Sequences for d2iiza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iiza_ d.58.4.14 (A:) Melanin biosynthesis protein TyrA {Shewanella oneidensis [TaxId: 70863]} nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld flmqfd
Timeline for d2iiza_: