![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.14: Dyp-type peroxidase-like [143265] (3 proteins) Pfam PF04261 |
![]() | Protein Melanin biosynthesis protein TyrA [143270] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [143271] (2 PDB entries) |
![]() | Domain d2iiza1: 2iiz A:5-310 [137444] automatically matched to 2HAG A:5-311 complexed with edo, hem, ipa, na |
PDB Entry: 2iiz (more details), 2.3 Å
SCOP Domain Sequences for d2iiza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iiza1 d.58.4.14 (A:5-310) Melanin biosynthesis protein TyrA {Shewanella oneidensis [TaxId: 70863]} nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld flmqfd
Timeline for d2iiza1: