Lineage for d2iiza_ (2iiz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949970Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
    Pfam PF04261
  6. 2949983Protein Melanin biosynthesis protein TyrA [143270] (1 species)
  7. 2949984Species Shewanella oneidensis [TaxId:70863] [143271] (2 PDB entries)
    Uniprot Q8EIU4 5-311
  8. 2949985Domain d2iiza_: 2iiz A: [137444]
    automated match to d2haga1
    complexed with edo, hem, ipa, na

Details for d2iiza_

PDB Entry: 2iiz (more details), 2.3 Å

PDB Description: crystal structure of putative melanin biosynthesis protein tyra with bound heme (np_716371.1) from shewanella oneidensis at 2.30 a resolution
PDB Compounds: (A:) Melanin biosynthesis protein TyrA, putative

SCOPe Domain Sequences for d2iiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iiza_ d.58.4.14 (A:) Melanin biosynthesis protein TyrA {Shewanella oneidensis [TaxId: 70863]}
nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
flmqfd

SCOPe Domain Coordinates for d2iiza_:

Click to download the PDB-style file with coordinates for d2iiza_.
(The format of our PDB-style files is described here.)

Timeline for d2iiza_: