Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller |
Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries) |
Domain d2iivb2: 2iiv B:509-766 [137442] Other proteins in same PDB: d2iiva1, d2iivb1 automatically matched to d1orva2 complexed with 565, nag; mutant |
PDB Entry: 2iiv (more details), 2.15 Å
SCOP Domain Sequences for d2iivb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iivb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d2iivb2: