SCOPe 2.07: Domain d2iivb1: 2iiv B:39-508

Lineage for d2iivb1 (2iiv B:39-508)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2iivb1: 2iiv B:39-508 [137441]
   Other proteins in same PDB: d2iiva2, d2iivb2
   automated match to d1orva1
   complexed with 565, nag

Details for d2iivb1

PDB Entry: 2iiv, 2.15 Å

PDB Description: human dipeptidyl peptidase 4 in complex with a diazepan-2-one inhibitor

PDB Compounds: (B:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d2iivb1:

Sequence; same for both SEQRES and ATOM records:

>d2iivb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d2iivb1:

• d2iivb1 first appeared in SCOP 1.73
  
• d2iivb1 appears in SCOPe 2.06
  
• d2iivb1 appears in the current release, SCOPe 2.08