SCOPe 2.07: Domain d2iita2: 2iit A:509-766

Lineage for d2iita2 (2iit A:509-766)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2iita2: 2iit A:509-766 [137436]
   Other proteins in same PDB: d2iita1, d2iitb1
   automated match to d1orva2
   complexed with 872, na, nag, ndg

Details for d2iita2

PDB Entry: 2iit, 2.35 Å

PDB Description: human dipeptidyl peptidase 4 in complex with a diazepan-2-one inhibitor

PDB Compounds: (A:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d2iita2:

Sequence; same for both SEQRES and ATOM records:

>d2iita2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2iita2:

• d2iita2 first appeared in SCOP 1.73
  
• d2iita2 appears in SCOPe 2.06
  
• d2iita2 appears in the current release, SCOPe 2.08