Lineage for d2iita2 (2iit A:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901312Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2901319Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2901320Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2901375Domain d2iita2: 2iit A:509-766 [137436]
    Other proteins in same PDB: d2iita1, d2iitb1
    automated match to d1orva2
    complexed with 872, na, nag

Details for d2iita2

PDB Entry: 2iit (more details), 2.35 Å

PDB Description: human dipeptidyl peptidase 4 in complex with a diazepan-2-one inhibitor
PDB Compounds: (A:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d2iita2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iita2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d2iita2:

Click to download the PDB-style file with coordinates for d2iita2.
(The format of our PDB-style files is described here.)

Timeline for d2iita2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iita1