SCOPe 2.06: Domain d2iima2: 2iim A:59-119

Lineage for d2iima2 (2iim A:59-119)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)

8. Domain d2iima2: 2iim A:59-119 [137434]
   Other proteins in same PDB: d2iima3
   automated match to d1h92a_
   complexed with ca, pg4, zn

Details for d2iima2

PDB Entry: 2iim, 1 Å

PDB Description: SH3 Domain of Human Lck

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2iima2:

Sequence; same for both SEQRES and ATOM records:

>d2iima2 b.34.2.1 (A:59-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
splqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvak
a

Timeline for d2iima2:

• d2iima2 first appeared in SCOP 1.73, called d2iima1
  
• d2iima2 was called d2iima_ in SCOPe 2.05
  
• d2iima2 appears in SCOPe 2.07
  
• d2iima2 appears in the current release, SCOPe 2.08