SCOPe 2.05: Domain d2iima_: 2iim A:

Lineage for d2iima_ (2iim A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)

8. Domain d2iima_: 2iim A: [137434]
   automated match to d1h92a_
   complexed with ca, pg4, zn

Details for d2iima_

PDB Entry: 2iim, 1 Å

PDB Description: SH3 Domain of Human Lck

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2iima_:

Sequence; same for both SEQRES and ATOM records:

>d2iima_ b.34.2.1 (A:) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
gsplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfva
ka

Timeline for d2iima_:

• d2iima_ first appeared in SCOP 1.73, called d2iima1
  
• d2iima_ appears in SCOPe 2.04
  
• d2iima_ is called d2iima2 in SCOPe 2.06
  
• d2iima_ appears in the current release, SCOPe 2.08, called d2iima2