Lineage for d2iima2 (2iim A:59-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783169Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)
  7. 2783170Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)
  8. 2783171Domain d2iima2: 2iim A:59-119 [137434]
    Other proteins in same PDB: d2iima3
    automated match to d1h92a_
    complexed with ca, pg4, zn

Details for d2iima2

PDB Entry: 2iim (more details), 1 Å

PDB Description: SH3 Domain of Human Lck
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2iima2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iima2 b.34.2.1 (A:59-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
splqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvak
a

SCOPe Domain Coordinates for d2iima2:

Click to download the PDB-style file with coordinates for d2iima2.
(The format of our PDB-style files is described here.)

Timeline for d2iima2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iima3