Lineage for d2iidd2 (2iid D:320-432)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935460Protein L-aminoacid oxidase [54397] (2 species)
  7. 2935466Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (3 PDB entries)
  8. 2935470Domain d2iidd2: 2iid D:320-432 [137433]
    Other proteins in same PDB: d2iida1, d2iidb1, d2iidc1, d2iidd1
    automated match to d1f8ra2
    complexed with fad, nag, phe

Details for d2iidd2

PDB Entry: 2iid (more details), 1.8 Å

PDB Description: structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine
PDB Compounds: (D:) L-amino-acid oxidase

SCOPe Domain Sequences for d2iidd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iidd2 d.16.1.5 (D:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan
ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt

SCOPe Domain Coordinates for d2iidd2:

Click to download the PDB-style file with coordinates for d2iidd2.
(The format of our PDB-style files is described here.)

Timeline for d2iidd2: