![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
![]() | Protein L-aminoacid oxidase [54397] (2 species) |
![]() | Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (3 PDB entries) |
![]() | Domain d2iidd2: 2iid D:320-432 [137433] Other proteins in same PDB: d2iida1, d2iidb1, d2iidc1, d2iidd1 automated match to d1f8ra2 complexed with fad, nag, phe |
PDB Entry: 2iid (more details), 1.8 Å
SCOPe Domain Sequences for d2iidd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iidd2 d.16.1.5 (D:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt
Timeline for d2iidd2: