Lineage for d2iidd1 (2iid D:4-319,D:433-486)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849441Protein L-aminoacid oxidase [51929] (2 species)
  7. 2849447Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries)
  8. 2849451Domain d2iidd1: 2iid D:4-319,D:433-486 [137432]
    Other proteins in same PDB: d2iida2, d2iidb2, d2iidc2, d2iidd2
    automated match to d1f8ra1
    complexed with fad, nag, phe

Details for d2iidd1

PDB Entry: 2iid (more details), 1.8 Å

PDB Description: structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine
PDB Compounds: (D:) L-amino-acid oxidase

SCOPe Domain Sequences for d2iidd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iidd1 c.3.1.2 (D:4-319,D:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
fnppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglr
aardvnlasen

SCOPe Domain Coordinates for d2iidd1:

Click to download the PDB-style file with coordinates for d2iidd1.
(The format of our PDB-style files is described here.)

Timeline for d2iidd1: