Lineage for d2iidb1 (2iid B:4-319,B:433-486)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688799Protein L-aminoacid oxidase [51929] (2 species)
  7. 688805Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries)
  8. 688807Domain d2iidb1: 2iid B:4-319,B:433-486 [137428]
    Other proteins in same PDB: d2iida2, d2iidb2, d2iidc2, d2iidd2
    automatically matched to d1f8ra1
    complexed with fad, fuc, nag, phe

Details for d2iidb1

PDB Entry: 2iid (more details), 1.8 Å

PDB Description: structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine
PDB Compounds: (B:) L-amino-acid oxidase

SCOP Domain Sequences for d2iidb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iidb1 c.3.1.2 (B:4-319,B:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
fnppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglr
aardvnlasen

SCOP Domain Coordinates for d2iidb1:

Click to download the PDB-style file with coordinates for d2iidb1.
(The format of our PDB-style files is described here.)

Timeline for d2iidb1: