SCOPe 2.08: Domain d2iidb1: 2iid B:4-319,B:433-486

Lineage for d2iidb1 (2iid B:4-319,B:433-486)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein L-aminoacid oxidase [51929] (2 species)

7. Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries)

8. Domain d2iidb1: 2iid B:4-319,B:433-486 [137428]
   Other proteins in same PDB: d2iida2, d2iidb2, d2iidc2, d2iidd2
   automated match to d1f8ra1
   complexed with fad, nag, phe

Details for d2iidb1

PDB Entry: 2iid, 1.8 Å

PDB Description: structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine

PDB Compounds: (B:) L-amino-acid oxidase

SCOPe Domain Sequences for d2iidb1:

Sequence; same for both SEQRES and ATOM records:

>d2iidb1 c.3.1.2 (B:4-319,B:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
fnppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglr
aardvnlasen

Timeline for d2iidb1:

• d2iidb1 first appeared in SCOP 1.73
  
• d2iidb1 appears in SCOPe 2.07