Lineage for d2ii0a1 (2ii0 A:566-1045)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775260Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 775261Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 775262Family a.117.1.1: Ras GEF [48367] (1 protein)
  6. 775263Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 775264Species Human (Homo sapiens) [TaxId:9606] [48369] (9 PDB entries)
    Uniprot Q07889 189-1046
  8. 775267Domain d2ii0a1: 2ii0 A:566-1045 [137425]
    automatically matched to d1nvus_

Details for d2ii0a1

PDB Entry: 2ii0 (more details), 2.02 Å

PDB Description: Crystal Structure of catalytic domain of Son of sevenless (Rem-Cdc25) in the absence of Ras
PDB Compounds: (A:) Son of sevenless homolog 1

SCOP Domain Sequences for d2ii0a1:

Sequence, based on SEQRES records: (download)

>d2ii0a1 a.117.1.1 (A:566-1045) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp

Sequence, based on observed residues (ATOM records): (download)

>d2ii0a1 a.117.1.1 (A:566-1045) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifegipiikagtviklierltyhmyadpnfvrtflttyr
sfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvlnv
crhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiafqsspptve
whisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnll
kmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnssp
vyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilktee
gnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsme
keftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp

SCOP Domain Coordinates for d2ii0a1:

Click to download the PDB-style file with coordinates for d2ii0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ii0a1: