SCOPe 2.07: Domain d2ihpb_: 2ihp B:

Lineage for d2ihpb_ (2ihp B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (9 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries)

8. Domain d2ihpb_: 2ihp B: [137422]
   automated match to d1e6aa_
   complexed with mes, mg, po4

Details for d2ihpb_

PDB Entry: 2ihp, 1.5 Å

PDB Description: Yeast inorganic pyrophosphatase with magnesium and phosphate

PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d2ihpb_:

Sequence; same for both SEQRES and ATOM records:

>d2ihpb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwffis

Timeline for d2ihpb_:

• d2ihpb_ first appeared in SCOP 1.73, called d2ihpb1
  
• d2ihpb_ appears in SCOPe 2.06
  
• d2ihpb_ appears in the current release, SCOPe 2.08