SCOPe 2.08: Domain d2ih9b3: 2ih9 B:344-559

Lineage for d2ih9b3 (2ih9 B:344-559)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Laccase, C-terminal domain [418907] (5 species)

7. Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419309] (9 PDB entries)

8. Domain d2ih9b3: 2ih9 B:344-559 [137418]
   Other proteins in same PDB: d2ih9a1, d2ih9a2, d2ih9b1, d2ih9b2
   automated match to d1gw0a3
   complexed with cl, cu, nag, so4
   has additional insertions and/or extensions that are not grouped together

Details for d2ih9b3

PDB Entry: 2ih9, 2 Å

PDB Description: a high-dose crystal structure of a recombinant melanocarbus albomyces laccase

PDB Compounds: (B:) Laccase-1

SCOPe Domain Sequences for d2ih9b3:

Sequence; same for both SEQRES and ATOM records:

>d2ih9b3 b.6.1.3 (B:344-559) Laccase, C-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

Timeline for d2ih9b3:

• d2ih9b3 first appeared in SCOP 1.73
  
• d2ih9b3 appears in SCOPe 2.07