Lineage for d2ih9b1 (2ih9 B:1-162)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791592Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 791600Species Melanocarpus albomyces [TaxId:204285] [74873] (4 PDB entries)
  8. 791616Domain d2ih9b1: 2ih9 B:1-162 [137416]
    automatically matched to d1gw0a1
    complexed with 5ax, bma, cl, cu, nag, so4

Details for d2ih9b1

PDB Entry: 2ih9 (more details), 2 Å

PDB Description: a high-dose crystal structure of a recombinant melanocarbus albomyces laccase
PDB Compounds: (B:) Laccase-1

SCOP Domain Sequences for d2ih9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih9b1 b.6.1.3 (B:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

SCOP Domain Coordinates for d2ih9b1:

Click to download the PDB-style file with coordinates for d2ih9b1.
(The format of our PDB-style files is described here.)

Timeline for d2ih9b1: