Lineage for d2ih9a3 (2ih9 A:344-559)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1774855Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 1774856Species Fungus (Melanocarpus albomyces) [TaxId:204285] [74873] (9 PDB entries)
  8. 1774889Domain d2ih9a3: 2ih9 A:344-559 [137415]
    automated match to d1gw0a3
    complexed with 5ax, cl, cu, nag, so4

Details for d2ih9a3

PDB Entry: 2ih9 (more details), 2 Å

PDB Description: a high-dose crystal structure of a recombinant melanocarbus albomyces laccase
PDB Compounds: (A:) Laccase-1

SCOPe Domain Sequences for d2ih9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih9a3 b.6.1.3 (A:344-559) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

SCOPe Domain Coordinates for d2ih9a3:

Click to download the PDB-style file with coordinates for d2ih9a3.
(The format of our PDB-style files is described here.)

Timeline for d2ih9a3: