Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Laccase [49557] (5 species) consists of three domains of this fold |
Species Melanocarpus albomyces [TaxId:204285] [74873] (4 PDB entries) |
Domain d2ih9a3: 2ih9 A:344-559 [137415] automatically matched to d1gw0a3 complexed with 5ax, bma, cl, cu, nag, so4 |
PDB Entry: 2ih9 (more details), 2 Å
SCOP Domain Sequences for d2ih9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ih9a3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad lrqrisqededdfnrvcdewraywptnpypkidsgl
Timeline for d2ih9a3: