Lineage for d2ih9a1 (2ih9 A:1-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 660933Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 660941Species Melanocarpus albomyces [TaxId:204285] [74873] (3 PDB entries)
  8. 660948Domain d2ih9a1: 2ih9 A:1-162 [137413]
    automatically matched to d1gw0a1
    complexed with 5ax, bma, cl, cu, nag, so4

Details for d2ih9a1

PDB Entry: 2ih9 (more details), 2 Å

PDB Description: a high-dose crystal structure of a recombinant melanocarbus albomyces laccase
PDB Compounds: (A:) Laccase-1

SCOP Domain Sequences for d2ih9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih9a1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

SCOP Domain Coordinates for d2ih9a1:

Click to download the PDB-style file with coordinates for d2ih9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ih9a1: