Lineage for d2ih9a1 (2ih9 A:1-162)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2367193Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 2367194Species Fungus (Melanocarpus albomyces) [TaxId:204285] [74873] (9 PDB entries)
  8. 2367243Domain d2ih9a1: 2ih9 A:1-162 [137413]
    automated match to d1gw0a1
    complexed with cl, cu, nag, so4

Details for d2ih9a1

PDB Entry: 2ih9 (more details), 2 Å

PDB Description: a high-dose crystal structure of a recombinant melanocarbus albomyces laccase
PDB Compounds: (A:) Laccase-1

SCOPe Domain Sequences for d2ih9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih9a1 b.6.1.3 (A:1-162) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

SCOPe Domain Coordinates for d2ih9a1:

Click to download the PDB-style file with coordinates for d2ih9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ih9a1: