SCOP 1.73: Domain d2ih8b1: 2ih8 B:1-162

Lineage for d2ih8b1 (2ih8 B:1-162)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Melanocarpus albomyces [TaxId:204285] [74873] (3 PDB entries)

8. Domain d2ih8b1: 2ih8 B:1-162 [137410]
   automatically matched to d1gw0a1
   complexed with bma, cl, cu, man, nag, ndg, oxy, so4

Details for d2ih8b1

PDB Entry: 2ih8, 2 Å

PDB Description: a low-dose crystal structure of a recombinant melanocarpus albomyces laccase

PDB Compounds: (B:) Laccase-1

SCOP Domain Sequences for d2ih8b1:

Sequence; same for both SEQRES and ATOM records:

>d2ih8b1 b.6.1.3 (B:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

Timeline for d2ih8b1:

• d2ih8b1 is new in SCOP 1.73
  
• d2ih8b1 appears in SCOP 1.75
  
• d2ih8b1 appears in the current release, SCOPe 2.08