Lineage for d2igyb_ (2igy B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1550156Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 1550157Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (19 PDB entries)
  8. 1550186Domain d2igyb_: 2igy B: [137406]
    automated match to d1leea_
    complexed with a2t

Details for d2igyb_

PDB Entry: 2igy (more details), 2.6 Å

PDB Description: Achiral, Cheap and Potent Inhibitors of Plasmepsins II
PDB Compounds: (B:) Plasmepsin-2

SCOPe Domain Sequences for d2igyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igyb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOPe Domain Coordinates for d2igyb_:

Click to download the PDB-style file with coordinates for d2igyb_.
(The format of our PDB-style files is described here.)

Timeline for d2igyb_: