SCOPe 2.08: Domain d2igyb_: 2igy B:

Lineage for d2igyb_ (2igy B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)

8. Domain d2igyb_: 2igy B: [137406]
   automated match to d1leea_
   complexed with a2t

Details for d2igyb_

PDB Entry: 2igy, 2.6 Å

PDB Description: Achiral, Cheap and Potent Inhibitors of Plasmepsins II

PDB Compounds: (B:) Plasmepsin-2

SCOPe Domain Sequences for d2igyb_:

Sequence; same for both SEQRES and ATOM records:

>d2igyb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d2igyb_:

• d2igyb_ first appeared in SCOP 1.73, called d2igyb1
  
• d2igyb_ appears in SCOPe 2.07