Lineage for d2igxa_ (2igx A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060885Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 2060886Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)
  8. 2060888Domain d2igxa_: 2igx A: [137404]
    automated match to d1leea_
    complexed with a1t

Details for d2igxa_

PDB Entry: 2igx (more details), 1.7 Å

PDB Description: achiral, cheap and potent inhibitors of plasmepsins ii
PDB Compounds: (A:) Plasmepsin-2

SCOPe Domain Sequences for d2igxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igxa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

SCOPe Domain Coordinates for d2igxa_:

Click to download the PDB-style file with coordinates for d2igxa_.
(The format of our PDB-style files is described here.)

Timeline for d2igxa_: