Lineage for d2igtb2 (2igt B:1-309)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130452Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 protein domains)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)
  6. 2130473Protein Putative methyltransferase Atu0340 [142636] (1 species)
    there is no associated PUA domain; rudiment extra N-terminal subdomain
  7. 2130474Species Agrobacterium tumefaciens [TaxId:358] [142637] (1 PDB entry)
    Uniprot Q8UIF7 1-309
  8. 2130476Domain d2igtb2: 2igt B:1-309 [137402]
    Other proteins in same PDB: d2igta2, d2igtb3, d2igtc3
    automated match to d2igta1
    complexed with acy, fmt, gol, sam

Details for d2igtb2

PDB Entry: 2igt (more details), 1.89 Å

PDB Description: crystal structure of the sam dependent methyltransferase from agrobacterium tumefaciens
PDB Compounds: (B:) SAM dependent methyltransferase

SCOPe Domain Sequences for d2igtb2:

Sequence, based on SEQRES records: (download)

>d2igtb2 c.66.1.51 (B:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}
mqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwrplvpdrv
wqnadaiftgdtdedgmgrwrfpkealgetwplsllgveflgrftafrhvgvfpeqivhw
ewlknavetadrplkvlnlfgytgvaslvaaaagaevthvdaskkaigwakenqvlagle
qapirwicedamkfiqreerrgstydiiltdppkfgrgthgevwqlfdhlplmldicrei
lspkalglvltaysirasfysmhelmretmrgaggvvasgelvireagldgktpgrvlst
slfsrwepk

Sequence, based on observed residues (ATOM records): (download)

>d2igtb2 c.66.1.51 (B:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}
mqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwrplvpdrv
wqnadaiftgdgmgrwrfpkealgetwplsllgveflgrftafrhvgvfpeqivhwewlk
navetadrplkvlnlfgytgvaslvaaaagaevthvdaskkaigwakenqvlagleqapi
rwicedamkfiqreerrgstydiiltdppkfgrgthgevwqlfdhlplmldicreilspk
alglvltaysirasfysmhelmretmrgaggvvasgelvireagldgktpgrvlstslfs
rwepk

SCOPe Domain Coordinates for d2igtb2:

Click to download the PDB-style file with coordinates for d2igtb2.
(The format of our PDB-style files is described here.)

Timeline for d2igtb2: