Lineage for d2igoh2 (2igo H:355-552)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180483Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2180484Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2180485Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2180526Protein Pyranose 2-oxidase [117843] (1 species)
  7. 2180527Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 2180545Domain d2igoh2: 2igo H:355-552 [137400]
    Other proteins in same PDB: d2igoa1, d2igob1, d2igoc1, d2igod1, d2igoe1, d2igof1, d2igog1, d2igoh1
    automatically matched to d1tzla2
    complexed with fad, shg; mutant

Details for d2igoh2

PDB Entry: 2igo (more details), 1.95 Å

PDB Description: crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose
PDB Compounds: (H:) Pyranose oxidase

SCOPe Domain Sequences for d2igoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igoh2 d.16.1.1 (H:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOPe Domain Coordinates for d2igoh2:

Click to download the PDB-style file with coordinates for d2igoh2.
(The format of our PDB-style files is described here.)

Timeline for d2igoh2: