Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Pyranose 2-oxidase [117439] (1 species) |
Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries) Uniprot Q8J136 43-619 |
Domain d2igoc1: 2igo C:43-354,C:553-619 [137389] Other proteins in same PDB: d2igoa2, d2igob2, d2igoc2, d2igod2, d2igoe2, d2igof2, d2igog2, d2igoh2 automatically matched to d1tzla1 complexed with fad, g2f; mutant |
PDB Entry: 2igo (more details), 1.95 Å
SCOP Domain Sequences for d2igoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igoc1 c.3.1.2 (C:43-354,C:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg gmstawtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv lnklteeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp anppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam slaiksceyikqnftpspft
Timeline for d2igoc1: