Lineage for d2igoa2 (2igo A:355-552)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 854921Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 854959Protein Pyranose 2-oxidase [117843] (1 species)
  7. 854960Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 854971Domain d2igoa2: 2igo A:355-552 [137386]
    Other proteins in same PDB: d2igoa1, d2igob1, d2igoc1, d2igod1, d2igoe1, d2igof1, d2igog1, d2igoh1
    automatically matched to d1tzla2
    complexed with fad, g2f; mutant

Details for d2igoa2

PDB Entry: 2igo (more details), 1.95 Å

PDB Description: crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose
PDB Compounds: (A:) Pyranose oxidase

SCOP Domain Sequences for d2igoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igoa2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOP Domain Coordinates for d2igoa2:

Click to download the PDB-style file with coordinates for d2igoa2.
(The format of our PDB-style files is described here.)

Timeline for d2igoa2: