Lineage for d2ignh2 (2ign H:355-552)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935246Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2935287Protein Pyranose 2-oxidase [117843] (1 species)
  7. 2935288Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 2935297Domain d2ignh2: 2ign H:355-552 [137384]
    Other proteins in same PDB: d2igna1, d2ignb1, d2ignc1, d2ignd1, d2igne1, d2ignf1, d2igng1, d2ignh1
    automatically matched to d1tzla2
    complexed with fad, mes; mutant

Details for d2ignh2

PDB Entry: 2ign (more details), 1.65 Å

PDB Description: crystal structure of recombinant pyranose 2-oxidase h167a mutant
PDB Compounds: (H:) Pyranose oxidase

SCOPe Domain Sequences for d2ignh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ignh2 d.16.1.1 (H:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOPe Domain Coordinates for d2ignh2:

Click to download the PDB-style file with coordinates for d2ignh2.
(The format of our PDB-style files is described here.)

Timeline for d2ignh2: