Lineage for d2ignf2 (2ign F:355-552)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 854921Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 854959Protein Pyranose 2-oxidase [117843] (1 species)
  7. 854960Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 854967Domain d2ignf2: 2ign F:355-552 [137380]
    Other proteins in same PDB: d2igna1, d2ignb1, d2ignc1, d2ignd1, d2igne1, d2ignf1, d2igng1, d2ignh1
    automatically matched to d1tzla2
    complexed with fad, mes; mutant

Details for d2ignf2

PDB Entry: 2ign (more details), 1.65 Å

PDB Description: crystal structure of recombinant pyranose 2-oxidase h167a mutant
PDB Compounds: (F:) Pyranose oxidase

SCOP Domain Sequences for d2ignf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ignf2 d.16.1.1 (F:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

SCOP Domain Coordinates for d2ignf2:

Click to download the PDB-style file with coordinates for d2ignf2.
(The format of our PDB-style files is described here.)

Timeline for d2ignf2: