| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
| Protein Pyranose 2-oxidase [117843] (1 species) |
| Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries) |
| Domain d2ignf2: 2ign F:355-552 [137380] Other proteins in same PDB: d2igna1, d2ignb1, d2ignc1, d2ignd1, d2igne1, d2ignf1, d2igng1, d2ignh1 automatically matched to d1tzla2 complexed with fad, mes; mutant |
PDB Entry: 2ign (more details), 1.65 Å
SCOP Domain Sequences for d2ignf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ignf2 d.16.1.1 (F:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt
Timeline for d2ignf2: