Lineage for d2igad1 (2iga D:4-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942671Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 2942685Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. 2942788Domain d2igad1: 2iga D:4-147 [137366]
    automated match to d1q0oa1
    complexed with ca, cl, fe2, gol, oxy, xx2, xx3, xxp

Details for d2igad1

PDB Entry: 2iga (more details), 1.95 Å

PDB Description: Structure of Homoprotocatechuate 2,3-Dioxygenase from B. fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations.
PDB Compounds: (D:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d2igad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igad1 d.32.1.3 (D:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

SCOPe Domain Coordinates for d2igad1:

Click to download the PDB-style file with coordinates for d2igad1.
(The format of our PDB-style files is described here.)

Timeline for d2igad1: