Lineage for d2ig0a2 (2ig0 A:1538-1603)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665804Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 665805Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)
  8. 665809Domain d2ig0a2: 2ig0 A:1538-1603 [137351]
    automatically matched to d1ssfa2
    complexed with mly, so4

Details for d2ig0a2

PDB Entry: 2ig0 (more details), 1.7 Å

PDB Description: Structure of 53BP1/methylated histone peptide complex
PDB Compounds: (A:) tumor suppressor p53-binding protein 1

SCOP Domain Sequences for d2ig0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig0a2 b.34.9.1 (A:1538-1603) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg

SCOP Domain Coordinates for d2ig0a2:

Click to download the PDB-style file with coordinates for d2ig0a2.
(The format of our PDB-style files is described here.)

Timeline for d2ig0a2: