![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (7 proteins) Pfam PF00567 |
![]() | Protein p53-binding protein 1, 53BP1 [110163] (1 species) duplication; contains two Tudor domains in tandem |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries) Uniprot Q12888 1485-1602 Uniprot Q12888 1484-1606 Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
![]() | Domain d2ig0a1: 2ig0 A:1485-1537 [137350] automatically matched to d1ssfa1 complexed with mly, so4 |
PDB Entry: 2ig0 (more details), 1.7 Å
SCOP Domain Sequences for d2ig0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig0a1 b.34.9.1 (A:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]} sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp
Timeline for d2ig0a1: