Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.20: Peptidase A4 [101656] (3 proteins) circular permutation of the canonical fold |
Protein automated matches [190327] (1 species) not a true protein |
Species Fungus (Scytalidium lignicola) [TaxId:5539] [187146] (2 PDB entries) |
Domain d2ifwb_: 2ifw B: [137349] automated match to d1s2ba_ complexed with acy, gol |
PDB Entry: 2ifw (more details), 2.3 Å
SCOPe Domain Sequences for d2ifwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifwb_ b.29.1.20 (B:) automated matches {Fungus (Scytalidium lignicola) [TaxId: 5539]} tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq itqviinnqdvtdcsvsgttvscsyv
Timeline for d2ifwb_: