Lineage for d2ifwa1 (2ifw A:1-206)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664307Family b.29.1.20: Peptidase A4 [101656] (2 proteins)
    circular permutation of the canonical fold
  6. 664311Protein Scytalidopepsin B [101657] (1 species)
  7. 664312Species Fungus (Scytalidium lignicola) [TaxId:5539] [101658] (4 PDB entries)
  8. 664316Domain d2ifwa1: 2ifw A:1-206 [137348]
    automatically matched to d1s2ba_
    complexed with aar, act, acy, gol, psa

Details for d2ifwa1

PDB Entry: 2ifw (more details), 2.3 Å

PDB Description: Crystal structure of scytalido-glutamic peptidase with a transition state analog inhibitor
PDB Compounds: (A:) Scytalidopepsin B

SCOP Domain Sequences for d2ifwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifwa1 b.29.1.20 (A:1-206) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

SCOP Domain Coordinates for d2ifwa1:

Click to download the PDB-style file with coordinates for d2ifwa1.
(The format of our PDB-style files is described here.)

Timeline for d2ifwa1: