| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.20: Peptidase A4 [101656] (3 proteins) circular permutation of the canonical fold |
| Protein automated matches [190327] (1 species) not a true protein |
| Species Fungus (Scytalidium lignicola) [TaxId:5539] [187146] (2 PDB entries) |
| Domain d2ifwa_: 2ifw A: [137348] automated match to d1s2ba_ complexed with acy, gol |
PDB Entry: 2ifw (more details), 2.3 Å
SCOPe Domain Sequences for d2ifwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifwa_ b.29.1.20 (A:) automated matches {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv
Timeline for d2ifwa_: