![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.20: Peptidase A4 [101656] (3 proteins) circular permutation of the canonical fold |
![]() | Protein automated matches [190327] (1 species) not a true protein |
![]() | Species Fungus (Scytalidium lignicola) [TaxId:5539] [187146] (2 PDB entries) |
![]() | Domain d2ifra_: 2ifr A: [137346] automated match to d1s2ba_ complexed with acy |
PDB Entry: 2ifr (more details), 1.95 Å
SCOPe Domain Sequences for d2ifra_:
Sequence, based on SEQRES records: (download)
>d2ifra_ b.29.1.20 (A:) automated matches {Fungus (Scytalidium lignicola) [TaxId: 5539]} tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq itqviinnqdvtdcsvsgttvscsyv
>d2ifra_ b.29.1.20 (A:) automated matches {Fungus (Scytalidium lignicola) [TaxId: 5539]} tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg dgtydawyewypevsddfitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnes sgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqit qviinnqdvtdcsvsgttvscsyv
Timeline for d2ifra_: