Lineage for d2ifra1 (2ifr A:1-206)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795280Family b.29.1.20: Peptidase A4 [101656] (2 proteins)
    circular permutation of the canonical fold
  6. 795284Protein Scytalidopepsin B [101657] (1 species)
  7. 795285Species Fungus (Scytalidium lignicola) [TaxId:5539] [101658] (4 PDB entries)
  8. 795286Domain d2ifra1: 2ifr A:1-206 [137346]
    automatically matched to d1s2ba_
    complexed with aar, act, acy, ta2

Details for d2ifra1

PDB Entry: 2ifr (more details), 1.95 Å

PDB Description: Crystal structure of Scytalido-glutamic peptidase with a peptide based transition state analog
PDB Compounds: (A:) Scytalidopepsin B

SCOP Domain Sequences for d2ifra1:

Sequence, based on SEQRES records: (download)

>d2ifra1 b.29.1.20 (A:1-206) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

Sequence, based on observed residues (ATOM records): (download)

>d2ifra1 b.29.1.20 (A:1-206) Scytalidopepsin B {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnes
sgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqit
qviinnqdvtdcsvsgttvscsyv

SCOP Domain Coordinates for d2ifra1:

Click to download the PDB-style file with coordinates for d2ifra1.
(The format of our PDB-style files is described here.)

Timeline for d2ifra1: