Lineage for d2ifra_ (2ifr A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044017Family b.29.1.20: Peptidase A4 [101656] (3 protein domains)
    circular permutation of the canonical fold
  6. 2044025Protein automated matches [190327] (1 species)
    not a true protein
  7. 2044026Species Fungus (Scytalidium lignicola) [TaxId:5539] [187146] (2 PDB entries)
  8. 2044027Domain d2ifra_: 2ifr A: [137346]
    automated match to d1s2ba_
    complexed with acy

Details for d2ifra_

PDB Entry: 2ifr (more details), 1.95 Å

PDB Description: Crystal structure of Scytalido-glutamic peptidase with a peptide based transition state analog
PDB Compounds: (A:) Scytalidopepsin B

SCOPe Domain Sequences for d2ifra_:

Sequence, based on SEQRES records: (download)

>d2ifra_ b.29.1.20 (A:) automated matches {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
itqviinnqdvtdcsvsgttvscsyv

Sequence, based on observed residues (ATOM records): (download)

>d2ifra_ b.29.1.20 (A:) automated matches {Fungus (Scytalidium lignicola) [TaxId: 5539]}
tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
dgtydawyewypevsddfitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnes
sgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqit
qviinnqdvtdcsvsgttvscsyv

SCOPe Domain Coordinates for d2ifra_:

Click to download the PDB-style file with coordinates for d2ifra_.
(The format of our PDB-style files is described here.)

Timeline for d2ifra_: