Lineage for d2ifgf1 (2ifg F:2-115)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891277Family g.17.1.3: Neurotrophin [57520] (4 proteins)
  6. 891278Protein beta-Nerve growth factor [57525] (2 species)
  7. 891279Species Human (Homo sapiens) [TaxId:9606] [57527] (3 PDB entries)
    Uniprot P01138
  8. 891285Domain d2ifgf1: 2ifg F:2-115 [137342]
    Other proteins in same PDB: d2ifga1, d2ifga2, d2ifga3, d2ifgb1, d2ifgb2, d2ifgb3
    automatically matched to d1wwww_
    complexed with bma, man, nag, ndg

Details for d2ifgf1

PDB Entry: 2ifg (more details), 3.4 Å

PDB Description: structure of the extracellular segment of human trka in complex with nerve growth factor
PDB Compounds: (F:) Beta-nerve growth factor

SCOP Domain Sequences for d2ifgf1:

Sequence, based on SEQRES records: (download)

>d2ifgf1 g.17.1.3 (F:2-115) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records): (download)

>d2ifgf1 g.17.1.3 (F:2-115) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

SCOP Domain Coordinates for d2ifgf1:

Click to download the PDB-style file with coordinates for d2ifgf1.
(The format of our PDB-style files is described here.)

Timeline for d2ifgf1: