Lineage for d2ifge1 (2ifg E:2-115)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749103Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 749104Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 749222Family g.17.1.3: Neurotrophin [57520] (4 proteins)
  6. 749223Protein beta-Nerve growth factor [57525] (2 species)
  7. 749224Species Human (Homo sapiens) [TaxId:9606] [57527] (3 PDB entries)
  8. 749229Domain d2ifge1: 2ifg E:2-115 [137341]
    Other proteins in same PDB: d2ifga1, d2ifga2, d2ifga3, d2ifgb1, d2ifgb2, d2ifgb3
    automatically matched to d1wwww_
    complexed with bma, man, nag, ndg

Details for d2ifge1

PDB Entry: 2ifg (more details), 3.4 Å

PDB Description: structure of the extracellular segment of human trka in complex with nerve growth factor
PDB Compounds: (E:) Beta-nerve growth factor

SCOP Domain Sequences for d2ifge1:

Sequence, based on SEQRES records: (download)

>d2ifge1 g.17.1.3 (E:2-115) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records): (download)

>d2ifge1 g.17.1.3 (E:2-115) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

SCOP Domain Coordinates for d2ifge1:

Click to download the PDB-style file with coordinates for d2ifge1.
(The format of our PDB-style files is described here.)

Timeline for d2ifge1: