Lineage for d2ifgb3 (2ifg B:36-191)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111716Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2111727Protein High affinity nerve growth factor receptor, N-terminal domain [141992] (1 species)
  7. 2111728Species Human (Homo sapiens) [TaxId:9606] [141993] (1 PDB entry)
    Uniprot P04629 36-191
  8. 2111730Domain d2ifgb3: 2ifg B:36-191 [137340]
    Other proteins in same PDB: d2ifga1, d2ifga2, d2ifgb1, d2ifgb2, d2ifge1, d2ifgf1
    automatically matched to 2IFG A:36-191

Details for d2ifgb3

PDB Entry: 2ifg (more details), 3.4 Å

PDB Description: structure of the extracellular segment of human trka in complex with nerve growth factor
PDB Compounds: (B:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d2ifgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifgb3 c.10.2.7 (B:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
cpdaccphgssglrctrdgaldslhhlpgaenltelyienqqhlqhlelrdlrglgelrn
ltivksglrfvapdafhftprlsrlnlsfnaleslswktvqglslqelvlsgnplhcsca
lrwlqrweeeglggvpeqklqchgqgplahmpnasc

SCOPe Domain Coordinates for d2ifgb3:

Click to download the PDB-style file with coordinates for d2ifgb3.
(The format of our PDB-style files is described here.)

Timeline for d2ifgb3: